PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG013821t3
Common NameTCM_013821
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family HD-ZIP
Protein Properties Length: 267aa    MW: 29636.7 Da    PI: 4.373
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG013821t3genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox41.52.3e-1350812556
                      --HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox 25 psaeereeLAkklgLterqVkvWFqNrRakek 56
                      +  e++ +LAk lgL+ rq+ +WFqNrRa++k
  Thecc1EG013821t3 50 LEPERKVQLAKDLGLQPRQIAIWFQNRRARWK 81
                      6678999************************9 PP

2HD-ZIP_I/II100.21.8e-32491182392
       HD-ZIP_I/II  23 kLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                        LeperKv+la++Lglqprq+a+WFqnrRAR+ktkqlEkdyeaL+++y++lk++ ++L ke+++L+ee+ 
  Thecc1EG013821t3  49 FLEPERKVQLAKDLGLQPRQIAIWFQNRRARWKTKQLEKDYEALQASYNSLKADYDNLLKEKDKLKEEVL 118
                       69****************************************************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003891.4E-72687IPR001356Homeobox domain
PROSITE profilePS5007113.3623683IPR001356Homeobox domain
SuperFamilySSF466894.28E-134893IPR009057Homeodomain-like
CDDcd000868.75E-124984No hitNo description
Gene3DG3DSA:1.10.10.601.4E-144990IPR009057Homeodomain-like
PfamPF000468.8E-115081IPR001356Homeobox domain
PRINTSPR000318.5E-65463IPR000047Helix-turn-helix motif
PROSITE patternPS0002705881IPR017970Homeobox, conserved site
PRINTSPR000318.5E-66379IPR000047Helix-turn-helix motif
PfamPF021831.2E-1583124IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MAGGRVYPSN TSSAGGSNNL SVLLQSQRVP SSSEPLDPLF IPGSSPSSFL EPERKVQLAK  60
DLGLQPRQIA IWFQNRRARW KTKQLEKDYE ALQASYNSLK ADYDNLLKEK DKLKEEVLQL  120
TDKLLVKEKE KGNSELSDVN KLSQEPPQKL VVAETASEGE ESKVSVVACK QEDISSAKSD  180
IFDSDSPHYT DGVHSSLLEA ADSSYPFEPD QSDLSQDEED NLSKGLLHPP SYIFPKLEDD  240
EYSDPPASSC NFGFPVEDHA FWSWAY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17583RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007037213.10.0Homeobox-leucine zipper protein HAT5 isoform 3
TrEMBLA0A061G3Y80.0A0A061G3Y8_THECC; Homeobox-leucine zipper protein HAT5 isoform 3
STRINGPOPTR_0015s07640.11e-116(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.11e-27homeobox 1
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]